SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9Z209 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9Z209
Domain Number 1 Region: 295-584
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.37e-26
Family WD40-repeat 0.0074
Further Details:      
 
Domain Number 2 Region: 16-123
Classification Level Classification E-value
Superfamily L domain-like 2.28e-18
Family Internalin LRR domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H9Z209
Sequence length 647
Comment (tr|H9Z209|H9Z209_MACMU) Leucine-rich repeat and WD repeat-containing protein 1 {ECO:0000313|EMBL:AFH29975.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=LRWD1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MGPLSARLLMQRGRPKSDRLGKIRSLDLSGLELLSEHLDPKLLCRLTQLQELDLSNNQLE
TLPDNLGLSHLRVLRCANNQLGDVTALCQFPKLEELSLEGNPFLTVNDNLKVSFLLPTLR
KVNGKDASSTYSQVENLNRELTSRVTAHWEKFMATLGPEEEAEKAQADFVKSAVRDVRYG
PESLSEFTQWRVRMISEELVASSRTQVHEADSPEKPPEAGAAHKPRARLAALKRPDDVPL
NLSPSKRACASPSAQVEGGPVAGSDGSQPALKLEPLHFLQCHSKNNSPQDLETQLWACAF
EPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTALMVVTQAGHKK
RWSVLAAAGLRGLVRLLHVRAGFCCGVIRAHKKAIATLCFSPAHETHLFTASYDKRIILW
DIGMPNQDYEFQASQLLTLDTTSIPLRLCPVASCPDARLLAGCEGGCCCWDVRLDQPQKR
RVCEVEFVFSEGSEASGRRVDGLAFVNEDVVASKGSGLGTICLWSWRQTWGGRGSQSTVA
VVVLARLQWSPTELAYFSLSACPDKGIVLCGDEEGNVWLYDVSNILKQPPPLPAAPQAPT
QILKWPQPWALGQAVTKTMVNTVVANASFTYLTALTDSNIVAIWGRL
Download sequence
Identical sequences A0A2K5V0X5 A0A2K6DFB2 H9Z209
9544.ENSMMUP00000015768 ENSMMUP00000015768 ENSMMUP00000015768 NP_001252971.1.72884 XP_005549370.1.63531 XP_011758311.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]