SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9ZA89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H9ZA89
Domain Number - Region: 88-132
Classification Level Classification E-value
Superfamily ISP domain 0.0641
Family Rieske iron-sulfur protein (ISP) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9ZA89
Sequence length 235
Comment (tr|H9ZA89|H9ZA89_MACMU) Cytokine-like protein 2-21 isoform a {ECO:0000313|EMBL:AFH32855.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=FAM3B OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MRPLVSGPLKVVFLVLASLCAWYSGYLLAELIPDAPLSSAAYSIHSIGERPVLKAPVPKR
QKCDHWTPCPSDTYAYRLLSGGGINKYAKICFEDDLLMGEKLGNVARGINIAIVNYVTGN
VTATQHFDMYEGDNSGPMIKFIQSAPPKSLLFMVTYDDGSTRLNNDAKNAIEELGSKEIR
NMKFRSSWVFLAAKGFELPSEIQREKINHSDTKNNRYSGWPAEIQIEGCIPKEPS
Download sequence
Identical sequences A0A096NIY2 A0A2K5X134 A0A2K6CSB9 H9ZA89
ENSMMUP00000005689 XP_005548710.1.63531 XP_011724297.1.29376 XP_014988334.1.72884 ENSPANP00000012930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]