SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9ZBK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9ZBK3
Domain Number 1 Region: 328-473
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.77e-22
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 
Domain Number 2 Region: 548-682
Classification Level Classification E-value
Superfamily PX domain 8.37e-22
Family PX domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9ZBK3
Sequence length 937
Comment (tr|H9ZBK3|H9ZBK3_MACMU) Sorting nexin-14 isoform a {ECO:0000313|EMBL:AFH33319.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=SNX14 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MVPWVRTIGEKLKQRLRLDVGREICRQYPLFCFLLLCLSVASLLLNRYIHVLMIFWSFVA
GVVTFYCSLGPDSLLPNIFFTIKYKPKQLGLQELFPQGHSCAVCGKVKCKRHRPSLLLEN
YQPWLDLKISSKVDASLSEVLELVLENFVYPWYRDVTDDESFVDELRITLRFFASVLIRR
IHKVDIPSIITKKLLKAAMKHIEVIVKARQKVKNTEFLQQAALEEYGPELHVALRSRRDE
LHYLRKLTELLFPYILPPKATDCRSLTLLIREILSGSVFLPSLDFLADPDTVNHLLIIFI
DDSPPEKATEPASPLVPFLQKFAEPRNKKPSVLKLELKQIREQQDLLFRFMNFLKQEGAV
HVLQFCLTVEEFNDRILRPELSNDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQ
RIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPTRNSK
FNRNTQKRGESFGISRIGSKIKGVFKSTTMEGAMLPNYGVAEGEDDFIEEGIVVMEDDSP
VEAVSTPNTPRNLAAWKISIPYVDFFEDPSSERKEKKERIPVFCIDVERNDRRAVGHEPE
HWSVYRRYLEFYVLESKLTEFHGTFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQ
HPELSNSQLLADFLSPNGGETQFLDKILPDVNLGKIIKSVPGKLMKEKGQHLEPFIMNFI
NSCESPKPKPSRPELTILSPTSENNKKLFNDLFKNNANRAENTERKQNQNYFMEVMTVEG
VYDYLMYVGRVVFQVPDWLHHLLMGTRILFKNTLEMYTDYYLQCKLEQLFQEHRLVSLIT
LLRDAIFCENTEPRSLQDKQKGAKQTFEEMMNYIPDLLVKCIGEETKYESIRLLFDGLQQ
PVLNKQLTYVLLDIVIQELFPELNKVQKEVTSVTSWM
Download sequence
Identical sequences A0A096MXA3 A0A2K5N089 A0A2K5UFU6 H9ZBK3
ENSPANP00000004514 XP_005552479.1.63531 XP_011945194.1.92194 XP_014992356.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]