SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9ZES5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9ZES5
Domain Number 1 Region: 8-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 2.09e-67
Family TRADD, N-terminal domain 0.0000000551
Further Details:      
 
Domain Number 2 Region: 217-301
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000155
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H9ZES5
Sequence length 308
Comment (tr|H9ZES5|H9ZES5_MACMU) Tumor necrosis factor receptor type 1-associated DEATH domain protein {ECO:0000313|EMBL:AFH34441.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_12877 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPEVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRTLAAALAQRSVALQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGTQGGDGEVTSAPS
QPPVPSLSDVKPPPAQTFLFQGQPVVNRPLSLQDQQTFARSVGLKWRKVGRSLQRGCRAL
RDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGL
TDPNGGLA
Download sequence
Identical sequences A0A2K5V3Z0 A0A2K6AXR7 H9ZES5
XP_005592259.1.63531 XP_011756216.1.29376 XP_014981852.1.72884 ENSMMUP00000032373 9544.ENSMMUP00000007768 ENSMMUP00000007768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]