SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9ZZK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9ZZK3
Domain Number 1 Region: 5-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.52e-51
Family RecA protein-like (ATPase-domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H9ZZK3
Sequence length 247
Comment (tr|H9ZZK3|H9ZZK3_FERFK) UPF0273 protein FFONT_0168 {ECO:0000256|HAMAP-Rule:MF_01076} KW=Complete proteome; Reference proteome OX=1163730 OS=Kam940). GN=FFONT_0168 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MSFTIERVKTWIPGLDELLNGGIPKRNVVIITGGPGTGKTILSQHFLYNGLVRGEASVYV
SLEEHPVQVRRAMATFGWDVKKFEEEGKFAIVDAFTSGIGEAAKREKYVVKSVDDVGELI
DVIRMAIKETNAQRVVIDSVSTLYMTKPAIARNTVMQLKRILSGLGTTSFLISQVSVTER
GFGGPGVEHAADGIIRLDLDEYDGQLLRSIIVWKMRGTAHDMRRHPFDITDKGIIIYHDK
VFKSHVM
Download sequence
Identical sequences H9ZZK3
gi|385805214|ref|YP_005841612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]