SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9ZZU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9ZZU8
Domain Number 1 Region: 4-246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.13e-55
Family ABC transporter ATPase domain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9ZZU8
Sequence length 315
Comment (tr|H9ZZU8|H9ZZU8_FERFK) ABC transporter related protein {ECO:0000313|EMBL:AFH42255.1} KW=Complete proteome; Reference proteome OX=1163730 OS=Kam940). GN=FFONT_0265 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MVIFLSDVAIKAEDVWKIYNQNHTDEVIALRGLNLEIKKGTITTLLGKNGAGKTTFLRII
ATQLIPTKGNISVLGYDVIKDVWKIREKIAVIPQDAKPLLFPSPLEFISSFLVMRGYSFS
DARKRAKETLSELEIPEEYWNRAAWDLSGGYQRRLLLAAVMASDSELILLDEPSVGLDPI
ARMELWGKITLLKKMGKTVLLTTHYMEEAEMLSDHVIIIDKGKKILEGNPKELINSFKWK
HKIEVLDECDISLMKKMGVLFGSRPPFVIYLNSSIDSVLEELNSNGCRASASLTTLEDVF
LYAVGEEKWSIIKEE
Download sequence
Identical sequences H9ZZU8
gi|385805309|ref|YP_005841707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]