SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0A073 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0A073
Domain Number 1 Region: 84-156
Classification Level Classification E-value
Superfamily Prefoldin 0.0000549
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I0A073
Sequence length 250
Comment (tr|I0A073|I0A073_FERFK) Cell division protein CdvA {ECO:0000313|EMBL:AFH42380.1} KW=Complete proteome; Reference proteome OX=1163730 OS=Kam940). GN=FFONT_0390 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MKMVIYTVDMLDKYVGQKVKDPYQRVVGSLASIYSNVDGNVNAVEILFGDINFKTLPAER
ILIQKDDIILLPEWKYSALKVIERLERARRRAKALDELYAKGEITRQSYEEFKANVSKDL
DTLKKDANEAKDMIKKRINELEDQIVQIEKAITALKMSYIAGEISERGYKPAADILRLNK
DRNLEEKNDAKKIMDLIVKLETSSLDVESVVKEVQNVTPQVPQVEQPIVVELHESAPQSD
NANVPAVSSQ
Download sequence
Identical sequences I0A073
gi|385805434|ref|YP_005841832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]