SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0A087 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0A087
Domain Number 1 Region: 38-120,294-447
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-36
Family Extended AAA-ATPase domain 0.023
Further Details:      
 
Domain Number 2 Region: 126-208
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.48e-19
Family TIP49 domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I0A087
Sequence length 453
Comment (tr|I0A087|I0A087_FERFK) RuvB-like 2 {ECO:0000313|EMBL:AFH42394.1} KW=Complete proteome; Reference proteome OX=1163730 OS=Kam940). GN=FFONT_0404 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MSIIEELPKVKEFKRIGFHSHIKGLGLDENGKAKQIADGLVGQIEAREAAGIVVQMIKEG
KMAGRGILFVGPTGTGKTALAVAIARELGEDTPFVEFTGSEIYSTEMKKTEMLMQTLRKS
IGVRIKEKRTVYEGAVKELKIRRLRNPYNPYMMIPREAKITLETKDENITLTVSEEITQQ
LLELGIKKGDVIWIDSQTGRIFKEGRLKEEAEEKSPYISSERIMEMPQGPIKKDKEIVHT
ITLHDLDIYFATRKAGLEILFGFSPLKEIGQDVRKEVDEQVKKWINDGMGEIIPGVLFID
DAHMLDLEAFSFLTRAMESELAPIIILATNRGITKIRGTDIESPHGMPLDLLDRLLIITT
RPYNRDEIKQIILIRSEEEDIPLSDDAIEELTNIGVNRSLRYAIQLMVPAKVLAIRKNKQ
KVTKEEVIEASAKFIDLKSSIDYITKYEQLMLH
Download sequence
Identical sequences A0A2J6N432 I0A087
gi|385805448|ref|YP_005841846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]