SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0A0D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0A0D0
Domain Number 1 Region: 13-299
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.23e-49
Family G proteins 0.00000066
Further Details:      
 
Domain Number 2 Region: 344-467
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 2.09e-31
Family Initiation factor IF2/eIF5b, domain 3 0.0000333
Further Details:      
 
Domain Number 3 Region: 475-600
Classification Level Classification E-value
Superfamily Translation proteins 1.04e-27
Family Elongation factors 0.0000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I0A0D0
Sequence length 606
Comment (tr|I0A0D0|I0A0D0_FERFK) Probable translation initiation factor IF-2 {ECO:0000256|HAMAP-Rule:MF_00100} KW=Complete proteome; Reference proteome OX=1163730 OS=Kam940). GN=FFONT_0447 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MIKLSGTSRIEEQKLRQPIVVVMGHVDHGKTTLLDKIRGTSVAKREPGEITQHVGASVVP
SRVIEQLAEPLKKIIPVKLKIPGLLFIDTPGHELFMNMRRIGGAISDFSILVVDIIEGFK
EQTVESLQLLRARKVPFLVAANKIDKIPGWKPYPNEAFINSYAKQSQRTKELLDERIYHL
MGELGRYGFNSDRFDRIKDFTRTVSIVPVSAKTGEGIPELLAMLAGLSQQYLKDRLIFTS
GNAKGVVLEVKEMPGLGNTIDVIIYDGILRKGDTIVLGSAEGPIVTKVRNLLMPKPLQEI
RSPEDKFLSVDEVVAAVGVKIVAPDLDNAVAGTQLYVANTPEEIEDAKNKILEELSKIKI
KTDKSGVVAKADTLGTLDALVEALKRNNIPVRIADIGNITKRDVVEASISKQDDETLGVI
LGFNVKVMPDAKEEAEKLNVKIMLNNIIYKLLEDYFNWKEEVKRLEKIKEMENLVWPAKF
RIIPGFVFRRSDPVIVGIEVLGGILKPGSPLMDEAGRKLGILQQIQDKGQSLKEAKPGMQ
VAISVKGNIMVGRQINEGDIIYTDVPDLHARTFLTKFKGDISDDVKMVLDEIIKIKRKSD
PLYAFV
Download sequence
Identical sequences I0A0D0
gi|385805491|ref|YP_005841889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]