SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0A0F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0A0F2
Domain Number 1 Region: 7-86,178-353
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.21e-63
Family Bacterial dinuclear zinc exopeptidases 0.0000055
Further Details:      
 
Domain Number 2 Region: 75-183
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 4.27e-30
Family Aminopeptidase/glucanase lid domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I0A0F2
Sequence length 367
Comment (tr|I0A0F2|I0A0F2_FERFK) Metalloexopeptidase, family M42 {ECO:0000313|EMBL:AFH42459.1} KW=Complete proteome; Reference proteome OX=1163730 OS=Kam940). GN=FFONT_0469 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MQNFNKDEYKKCLRKYSQANGPSGMEDEVRDLLIEDLKPYADRIWIDSMGNVISLKKGVS
GKKLMIAAHMDEISLIVKYIDDNGFLRFSPVGGWSERILPATRVKVRTNKGDWIPGVIGV
KPPHLITPEEEKKVIEMNKLFIDVGASSRQEALSMGIEHGSRVLLDYDFADLIGNRVTGK
AFDDRAGLVVALKTFMEVEPNDIDLYFVATVQEEVGLKGARTSAYQISPDVAIALDVTTA
NDVPDVDEQDQVAKLGKGPAIKIIDGRSGSGLITNTAVLEKMISVAKERGIPYQAEVLTG
GTTDSSAIQLTKEGVPAGTISIPARYIHSPVEVIDLVDIHYSVELLKAFYESLKPEWIDS
IKEKIIK
Download sequence
Identical sequences I0A0F2
gi|385805513|ref|YP_005841911.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]