SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0A180 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0A180
Domain Number 1 Region: 212-351,410-536
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.29e-42
Family Tandem AAA-ATPase domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I0A180
Sequence length 559
Comment (tr|I0A180|I0A180_FERFK) Type III restriction enzyme, res subunit {ECO:0000313|EMBL:AFH42737.1} KW=Complete proteome; Reference proteome OX=1163730 OS=Kam940). GN=FFONT_0749 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MSGNDIAGGNQLKFRVKGWIDREIFANLMRFSDYKGRENGESLFEINYKKIRENGITLEE
VLNTLKSLGDKVPPLSIQALENIIKGGNKITLYLENDEIVLKPNSYIKDLFVNLKEYLVY
EREKKIFKVYPGKYFDLLKKAKDIGLEIENKTGLPDSLKMSKKINFKGELRNYQKEALES
WKNNSSRGIIALPTGSGKTVIGAAAIAELGEMTLIITYTKEQLLQWMEMLKNFTDIPQSM
IAAFYSEEKRIAPITISTYQTAFRHIKTLAYRFSLLVVDEVHHLPADKFKTIALGMYSPH
RLGLSATVIREDGKHVELFPLMGGVIYYKTPQELVEKGFLSPYASYIVKVGLSKEEEEKY
EKLKNIYKALTLGIPFAEVLKRAKSGDSRMAKALKIHNEMVQIYQKAKAKEEAVKKIVEQ
ELKNGSKILVFTQYVEQAEKLGNMLGAPVLTGSTETKLRKKILEDFKKAQSGVLVLTTVG
DEGLDIPDVNVGIIVAGTGSRRQFVQRLGRLLRPKPEKTAKLYEIVTKGTAEESLARKRK
KLEIDSDEKEKKSKQTKLF
Download sequence
Identical sequences I0A180
gi|385805791|ref|YP_005842189.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]