SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0A1F6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0A1F6
Domain Number 1 Region: 160-408
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.35e-71
Family Extended AAA-ATPase domain 0.0000014
Further Details:      
 
Weak hits

Sequence:  I0A1F6
Domain Number - Region: 16-82
Classification Level Classification E-value
Superfamily Prefoldin 0.00759
Family Prefoldin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I0A1F6
Sequence length 424
Comment (tr|I0A1F6|I0A1F6_FERFK) Proteasome regulatory particle {ECO:0000256|HAMAP-Rule:MF_00553} KW=Complete proteome; Reference proteome OX=1163730 OS=Kam940). GN=FFONT_0825 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MESADDISNANSTNVLAHIKYLEEKLKVLEEEKARLEKDINSYKEEKEKYIKYLEEKIKE
LEEEKLMLNREVKYYKEEMEKLLAPPLIEASVLDILPDKRVVVRSSTGPNLIVTVSGNIS
VDQLLPGTIVAINQRGSSIVEVLPQREDPYVKAMEVIERPNVKYKDIGGLSKQIQEVRET
VELPLKKPELFKKIGIEPPKGILLYGSPGTGKTMLAKAVASETNATFIRVVGSEFVQKFI
GEGARIVREVFELAKRKAPAIIFIDEIDAIAARRIDIGTSGEREVQRTMMQLLAEMDGFD
PLDNVKVIAATNRIDILDPAILRPGRFDRIIEVPLPDKQGRIEIFKIHIKKMNVEKNLDI
RKLSELTEGFVGADIKAVCVEAGYNAIREERDLVTMEDFIKAIEKIKGRKKEVEPEVPQV
STAY
Download sequence
Identical sequences A0A2J6N4P8 I0A1F6
gi|385805867|ref|YP_005842265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]