SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0A2P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0A2P4
Domain Number 1 Region: 15-141
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000000824
Family Prefoldin 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I0A2P4
Sequence length 143
Comment (tr|I0A2P4|I0A2P4_FERFK) Uncharacterized protein {ECO:0000313|EMBL:AFH43251.1} KW=Complete proteome; Reference proteome OX=1163730 OS=Kam940). GN=FFONT_1263 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MEYMSRTVQIDAEALLQTVANLEKYLESLRNAIGLLNERLLEVKIAREALKRINSENTSD
IIVSMDKDSNLMVKLKANIDGNPLVHLGLDIYAELPYDRAESVLAERENSITEELKRMSK
EYDEKNKEYQKLQSLIYALSQQR
Download sequence
Identical sequences I0A2P4
gi|385806305|ref|YP_005842703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]