SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0A2Z0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0A2Z0
Domain Number 1 Region: 7-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.44e-39
Family Extended AAA-ATPase domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I0A2Z0
Sequence length 458
Comment (tr|I0A2Z0|I0A2Z0_FERFK) Clamp loader large subunit {ECO:0000256|HAMAP-Rule:MF_01508} KW=Complete proteome; Reference proteome OX=1163730 OS=Kam940). GN=FFONT_1359 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MSAEKGLPWIIKYRPKSLKEYVNQETAVAIITSWIKDWEKRAPTKKAVLLYGPPGVGKTS
LIEALANDYGYEIVETNASDYRRRDDIYRKVYNSAIQGTLTGRKKLILLDEVDGLSSTGD
KGGIEAIVQLITQTKNPIILTANNAFHPDLKPIRDLAVMIELKNLNQKHVLTVLKIICER
EGVECEDAGLKVIYEKNRGDLRACINDLQSIAEVYGKVNEELATELTYYRDRELNPFDTL
RNIFTSKYVWQSRNAISHSEVDTDTLIEWLSENIPVQLTDPEDAYLAFQALSRADVYRGI
IKKTGNYDFLAYITEMIGPAISFSRKKTKFKWLKYNYPSKLKMLSETKRSRELLNSSLQK
LSKRLSQSTSKSKKDLLPYLRSIYRLSPPHFVQICRSYGITVEEAAVIVGDKQVEKAFAE
MAAERQEKSAEKAEISRTQAKRAKGRTSKKRGGQTQLF
Download sequence
Identical sequences I0A2Z0
gi|385806401|ref|YP_005842799.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]