SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0BJW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0BJW7
Domain Number 1 Region: 79-198
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000471
Family SMI1/KNR4-like 0.011
Further Details:      
 
Domain Number 2 Region: 205-270
Classification Level Classification E-value
Superfamily ClpS-like 0.0000314
Family Ribosomal protein L7/12, C-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I0BJW7
Sequence length 286
Comment (tr|I0BJW7|I0BJW7_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AFH62664.1} KW=Complete proteome OX=997761 OS=Paenibacillus mucilaginosus K02. GN=B2K_18380 OC=Paenibacillus.
Sequence
MALRAGTGRRPRVTLEILSIKVVISVETVYQEIDAVIAKMQAALEEKREQHPDHYAKYPM
QLMTTAEDQALRSVTGTWSLPEEYLYFLKHYVPESVSWSTDEYMNMDIYGAKDLLQGQSG
YNYNHVTDEVIADWPRDYLVIASDEGDPYCIDLSRGDTVIYTAVHGAGSWDFSVAYDNLL
EFLHSMLRPASTGEWEDGADEPYDYCHVYITGPGTDKIKTWVFIKKRFSCDYAQAKTYLE
AAPLLVYKGLDSGAVKLVDELKSIGADYELRQISQDEFLGIGSYRS
Download sequence
Identical sequences H6NMQ1 I0BJW7
gi|379721406|ref|YP_005313537.1| WP_014370350.1.53882 WP_014370350.1.63014 gi|386724103|ref|YP_006190429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]