SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0F6C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0F6C6
Domain Number 1 Region: 231-370
Classification Level Classification E-value
Superfamily CBS-domain pair 2.78e-27
Family CBS-domain pair 0.0022
Further Details:      
 
Domain Number 2 Region: 381-458
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.0000000000000545
Family CorC/HlyC domain-like 0.0035
Further Details:      
 
Weak hits

Sequence:  I0F6C6
Domain Number - Region: 194-221
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0628
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I0F6C6
Sequence length 460
Comment (tr|I0F6C6|I0F6C6_9BACI) YqhB {ECO:0000313|EMBL:AFI29032.1} KW=Complete proteome OX=1127744 OS=Bacillus sp. JS. GN=MY9_2499 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSIFRWYGMEKDIGKGRCMPSLEKAVVLEFVNLLAVAILILLTGFFVAIEFSIVKVRRSR
IDQLVAKGKKGAKAAKHVITHLDEYLSACQLGITVAALGLGWLGEPTVQTLLRPLFHKAG
LNESLTHLLSLVIAFLAVTYLNVVIGELAPKSFAIQKAESITLLFAKPLIWFYKIMFPFI
WLLNHSARLITGVFGLKPASEHELAYTEEELRVLLAESYKSGEIRKSELKYMNNIFTFDK
RMAKEIMVPRNEMVSLSLDEGSISNLQETVKQTKYTRYPVVREDKDNVIGVINMKEVLFS
MLTKDFSLKKHQIEPFVQPVIHVIETIPIYKLLLKMQKERTHMAILIDEYGGTSGLVTVE
DIIEEIVGEIRDEFDADEVPHIRELGKDHYLLNAKLLITDVNSLLGTDLSDAEVDTLGGW
FLTQNIDAEPESVIEYDGYSFKVKDIDSHHILFIEVKKAE
Download sequence
Identical sequences I0F6C6
gi|386759072|ref|YP_006232288.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]