SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0F9Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0F9Q5
Domain Number 1 Region: 27-121
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000379
Family SMI1/KNR4-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I0F9Q5
Sequence length 183
Comment (tr|I0F9Q5|I0F9Q5_9BACI) Uncharacterized protein {ECO:0000313|EMBL:AFI30211.1} KW=Complete proteome OX=1127744 OS=Bacillus sp. JS. GN=MY9_3679 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MLLPEEFNRNWDVNKNGPLLKFPYDDLIEVPFSEDFKQFLSIGGLPETPPPYLDFTSSQT
SFKPITSIFDMSEAFQKYWLLGSTGSGDPVCIVESNERIVYLDNGNEYKEVFINSSINQF
AECILLFSEMIDKAIHINGEDAFIDNDIPEDVIEWLKEELKRVDSNCTREGSFWGTEIEN
LYE
Download sequence
Identical sequences I0F9Q5
gi|386760250|ref|YP_006233467.1| WP_014665641.1.91225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]