SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0FL67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0FL67
Domain Number 1 Region: 38-351
Classification Level Classification E-value
Superfamily ClpP/crotonase 9.29e-64
Family Crotonase-like 0.00012
Further Details:      
 
Domain Number 2 Region: 361-543
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.83e-50
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000581
Further Details:      
 
Domain Number 3 Region: 543-646
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 5.53e-27
Family HCDH C-domain-like 0.00053
Further Details:      
 
Domain Number 4 Region: 669-762
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 2.38e-21
Family HCDH C-domain-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I0FL67
Sequence length 763
Comment (tr|I0FL67|I0FL67_MACMU) Trifunctional enzyme subunit alpha, mitochondrial {ECO:0000313|EMBL:AFI35193.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=HADHA OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MVACRAIGILSRFSAFRILRSRGYICRNFTGSSALLTRTHINYGVKGDVAVVRINSPNSK
VNTLSKELHSEFTEVMNEIWASDQIRSAVLISSKPGCFIAGADINMLSACKTLQEVTQLS
QEAQRILEKLEKSPKPVVAAINGSCLGGGLELAISCQYRIATKDRKTVLGVPEVLLGALP
GAGGTQRLPKMVGVPAALDMMLTGRNIRADRAKKMGLVDQLVEPLGPGLKPPEERTMEYL
EEVAITFAKGLADKKISPKRNKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPA
PLKIIDVVKTGIEQGSDAGYLSESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKD
VKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTGLDRGQQQVFKGLNDKVKKKALTSF
ERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCIFASNTSALP
ISEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSRDTSASAVAVGLKQGKVIIVVK
DGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVA
EDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLK
LPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRF
VDLYGAQTIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ
Download sequence
Identical sequences A0A2K5WXU8 A0A2K6E7T3 I0FL67
ENSMMUP00000005853 9544.ENSMMUP00000005853 ENSMMUP00000005853 NP_001252819.1.72884 XP_005576406.1.63531 XP_011736352.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]