SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0FUJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0FUJ6
Domain Number 1 Region: 187-223
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000235
Family CCCH zinc finger 0.00017
Further Details:      
 
Domain Number 2 Region: 150-185
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000471
Family CCCH zinc finger 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I0FUJ6
Sequence length 492
Comment (tr|I0FUJ6|I0FUJ6_MACMU) Zinc finger protein 36, C3H1 type-like 2 {ECO:0000313|EMBL:AFI38122.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ZFP36L2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASN
LHALAHPAPSPGSCSPKFPGAANGSSCGSAAAGGPTSYGTLKEPSGGGGTALLNKENKFR
DRSFSENGDRSQHLLHLQQQQKGGGGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGF
HELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERRPAPSGGASGDLRAFGTRD
ALHLGFPREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLLDSPTSRTPPPPSCSSASSCS
SSASSCSSASAASTPSAPACCASAAAAAAAALLYGSGGAEDLLAPGAPCAACSSASCANN
AFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQGLAPPAQPPAPPSAPLPAGAA
APPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDPGRR
LPIFSRLSISDD
Download sequence
Identical sequences A0A096MWJ3 A0A0D9RJV1 I0FUJ6
ENSPANP00000004249 XP_007968999.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]