SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0GYH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0GYH1
Domain Number 1 Region: 70-172
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.83e-33
Family N-utilization substance G protein NusG, N-terminal domain 0.0000561
Further Details:      
 
Domain Number 2 Region: 194-249
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.31e-16
Family N-utilization substance G protein NusG, C-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I0GYH1
Sequence length 249
Comment (tr|I0GYH1|I0GYH1_ACTM4) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome; Reference proteome OX=512565 OS=/ JCM 3121 / NCIMB 12654 / NBRC 102363 / 431). GN=AMIS_5880 OC=Actinoplanes.
Sequence
MPEYDDETAQFADEQSSLDTDESVEAAATSVATQAPEADETSEPAAAPEADEDYDPVKEL
RQKLRYAPGDWYVVHSYAGYENKVKTNLETRITSLDMEEFIFQVEVPTREEVEVKNGKRN
QVQAKVFPGYILVRMDLTPESYSCVRNTPGVTGFVGATDRVDRPAPLSLDEVLKWLAPAV
AAEEKKAKPEVKVLDFEVGDSVTVTDGAFASLPASISEINADQQKLKVLVSIFGRETPVE
LNFNQVTKI
Download sequence
Identical sequences I0GYH1
WP_014440708.1.27 gi|383775758|ref|YP_005460324.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]