SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0I2V3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0I2V3
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 6.02e-32
Family Thiamin pyrophosphokinase, catalytic domain 0.001
Further Details:      
 
Domain Number 2 Region: 149-200
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.000000000432
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I0I2V3
Sequence length 223
Comment (tr|I0I2V3|I0I2V3_CALAS) Thiamine pyrophosphokinase {ECO:0000313|EMBL:BAL99590.1} KW=Complete proteome; Reference proteome OX=926550 OS=STL-6-O1). GN=CLDAP_15510 OC=Caldilinea.
Sequence
MRAIVAVNGLIQDYALLQPLLHSDAYRVAADGGAMHWLALGHAPHVVVGDLDSLPAELVE
RLAAQGVRIERHPREKDQTDIELAIERAIEDGADEVLLIGALGGRLDQTLANVLLLAQRS
WPVPIRLIEGGQIAEVLRGPGTIEFTGTPGDVVSLLPLSPTVQGVTYRGLRYPLENAELS
FGTTRAISNEMLEPNASIFIQQGIALVVRTLNYLSDEEPGDEP
Download sequence
Identical sequences I0I2V3
gi|383762506|ref|YP_005441488.1| WP_014432829.1.81527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]