SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0K7A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0K7A6
Domain Number 1 Region: 242-421
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.02e-19
Family Glutathione peroxidase-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I0K7A6
Sequence length 426
Comment (tr|I0K7A6|I0K7A6_9BACT) Alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen {ECO:0000313|EMBL:CCH00009.1} KW=Complete proteome; Reference proteome OX=1166018 OS=Fibrella aestuarina BUZ 2. GN=FAES_2000 OC=Fibrella.
Sequence
MYANSTRFRSASLLLTGLIGLSSGVCAQSAAPLPEGPYRGEFQTATGKVPFNFAVKGTTA
YLLNAGEREALPGIRQQGDSVFIAIPLYDATLRFKREGNRLTGSYRAGSGQPIPVTAEFG
RSDRYEQGAAPTVSLEGKWDIGIQRSAGNPADVNQTVGVFSQQGSRVTGTILTTTGDYRY
LDGHVTGNRFALSAFSGASPAVFQGEIGPDGKLTGEFRYVRGASPATGVKNPAAKLPDLY
SLTYLKPGYKKLDFTFPAVNRGDESGKPVSLTDAKYKDKVVIVTILGSWCPNCIDETAFL
APWYKANRQRGVEVIGLAFERKNDLAFAKTALSRLINRYDVQYDILFAGLADKNVASAAL
PALNKVLAFPTTIILDRQGNVAQIHTGYTGPATGTYYDEYVAEFNQTIDKLLRNEPLTAE
TAHGGN
Download sequence
Identical sequences I0K7A6
WP_015331108.1.89626 gi|436835386|ref|YP_007320602.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]