SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0K8C2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0K8C2
Domain Number 1 Region: 244-391
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.19e-31
Family Glutathione peroxidase-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I0K8C2
Sequence length 392
Comment (tr|I0K8C2|I0K8C2_9BACT) Thiol-disulfide oxidoreductase resA {ECO:0000313|EMBL:CCH00375.1} KW=Complete proteome; Reference proteome OX=1166018 OS=Fibrella aestuarina BUZ 2. GN=FAES_2366 OC=Fibrella.
Sequence
MMKKSIGVGLLLLTLSASAQTTPFVLHGRLDQSPAKWIYLKYVDRTGEEKLDSAQITQGA
FIFTGQLSQPTKALIKTNRTIIPDEENLNIALIFLEPTTMQVKAVHNQFRSLTLKGSKTH
DEFNRLTALHAPYLKQYFSLRERSAQLAKQSPQTGDGDSRQSQQDSINQAIVANAVAKRL
VSYRFIEDNPNSWASAYELDFFKSTWPVDSVRRLYGRLNPNIQESLIGQRIAEKITMLDQ
ANTAVGTIAADFSAIDASGHPIRLADYKGRYVLLDFWGSWCAPCRAGNPHLRKLYQAYRQ
KGIEFIGIACEDKPVAWRTAIEKDSIGVWKHILDTEMKGDRVVGSQKSIARKYAVDSFPT
KVLIDPKGVIVGRYNGGNDSQLDEKLKDVLGN
Download sequence
Identical sequences I0K8C2
WP_015331474.1.89626 gi|436835752|ref|YP_007320968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]