SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0KBP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0KBP8
Domain Number 1 Region: 212-337
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.7e-24
Family Glutathione peroxidase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I0KBP8
Sequence length 345
Comment (tr|I0KBP8|I0KBP8_9BACT) Alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen {ECO:0000313|EMBL:CCH01551.1} KW=Complete proteome; Reference proteome OX=1166018 OS=Fibrella aestuarina BUZ 2. GN=FAES_3544 OC=Fibrella.
Sequence
MSTTVRFALALLLLSTQAISQVTEKGFVLIGQLEGADSLKKAVLTRLDSRQVDTVAINQG
RFTFSGNVPRPTVALIGTDKVRAGLGVWLTNDTIRATFNVVSYSERFRLLQPLSVSGPSE
SVDYLANMNALNYYNKLDLTKEKRNQLKADFIYEYVSKHPNSAYAAFFLRMNADYIAPDV
TKELLASLSPALQQSEEGESIRKSIARNEATTLGKTVGNLTLPDHTGQLQTVNTTSKPFT
LLYFWASWCGPCRKHNPDLVRLYRQVDPGRLQLISVSLDTDKSAWLKAIRQDGLQWTQLS
DLKGWESPVAKQFALFGIPQTILLDQSGRIIAVDASEASRLLTTR
Download sequence
Identical sequences I0KBP8
gi|436836928|ref|YP_007322144.1| WP_015332650.1.89626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]