SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0T0D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0T0D9
Domain Number 1 Region: 175-461
Classification Level Classification E-value
Superfamily CAC2185-like 1.83e-91
Family CAC2185-like 0.0000613
Further Details:      
 
Domain Number 2 Region: 4-207
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000000000000267
Family Spore coat polysaccharide biosynthesis protein SpsA 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I0T0D9
Sequence length 462
Comment (tr|I0T0D9|I0T0D9_STRMT) PF08942 domain protein {ECO:0000313|EMBL:EID29092.1} KW=Complete proteome OX=1095736 OS=Streptococcus mitis SK575. GN=HMPREF1048_0888 OC=Streptococcus.
Sequence
MTYSISVVLLQQGDRNSLLESLSIVERQTLKDIEVIIVNQSTEEIVSISQQMDLSFNIKI
IDENSFAELSDMITGDYITFLSSNDSLFDWTFEKMYHAIRLSDSDVVLGNFADLVDGVFY
FYPWGDNWLTENLTNYQVLQKMDDTDHRIRKQYCSLFGKLFNSKLLRKINQFDKNNLIWR
LYIHSKTATYINFPTYIYKPVVDAKPLKDSYKIILENYENRIKDCSVLENYDIERAKKQY
IQELANFSAWLKNDGEHLDSEIVYHKLIAAEKGIFPFLDLDRLDFTIISNNCVGGLIYKQ
LGFQYRTPFVGLFILPDDYYKLTKDFRYYMEQELVFEEELISPSWTHEVYPLGHLGDIDI
HFLHYSSIEEARTKWEKRKKRINWDNLYFKFDNKDSASEEILSKMDNLPYSNKLILVNRP
YKNLKSQCVIPGQEHLSELAIMPDPLNTFDVMDWLKKGGNAI
Download sequence
Identical sequences A0A081QYH7 I0T0D9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]