SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0YME7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0YME7
Domain Number 1 Region: 46-245
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-21
Family Protein kinases, catalytic subunit 0.02
Further Details:      
 
Domain Number 2 Region: 613-669
Classification Level Classification E-value
Superfamily HMG-box 0.000000000209
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I0YME7
Sequence length 670
Comment (tr|I0YME7|I0YME7_COCSC) Uncharacterized protein {ECO:0000313|EMBL:EIE19566.1} KW=Complete proteome; Reference proteome OX=574566 OS=Coccomyxa subellipsoidea (strain C-169) (Green microalga). GN=COCSUDRAFT_44434 OC=Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa.
Sequence
MGSCACAGQLWALILLLLQASCVDNLQSLIDEGGAYLAEDAAVTAVIVTRQDEHFVVKRA
KSSETCENEAIILEHLAEQGAMGVPRCLGTSTFQRAKENEMHVIVLTYLGKQLPLDELKK
PEVRKQLADVLTEVHCCGVVNGDLKPSHIRVDDKGRVSIADWDLGAFRTKTGGTKVHEWV
KKGFQKDIYLKQLPHEHFWGVFEGTPTWAAPSTHLGYGPSVAGDFGSFGLICAAAISGKA
PWSEPLVKRRLNQQIDHAVLSVLLTLGLPAVIQAKVHVSPSGCDGGIVWADFWAHQRALA
VHAQSGVTEEQAAVAFAQYICGMGTSQVGAAHVAKVKRSYYGLHGQQIKGTAEETASGSS
DLGIDEAVGEEADLLLKKELSLALDIDIPEKAQDHKFKLQEEMALGALRRSDDKGDITVA
PDIFFPVKGISRVSIEDMLMGGDLNFEPVSLGARVQVDTGALKASEHPGEIELTQLIGEV
VVTKNPLSVLNKIGQLEVALYAAGAKADPAQRHPLDAFVRSESERAKLLFARKETSLAFN
TVAGDMARLEDKVDALVSIVQGLAQDFQDMRGTTTGAQSSPPAPAPATAPSAPSPVPSAT
PSALPSGSPSHRSGKKLRKPRRRSAYDIFRQQRGPAILDEHGPAPFPERAKILGRAWKAL
SDAEKRRYEG
Download sequence
Identical sequences I0YME7
XP_005644110.1.71052 jgi|Coc_C169_1|44434|fgenesh1_pg.18_#_36 jgi|Chlvu1|76412|fgeneshCV_pg.C_scaffold_18000199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]