SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1GNL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1GNL1
Domain Number 1 Region: 44-360
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.71e-106
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 359-405,435-565
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-31
Family Glycosyl hydrolases family 32 C-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1GNL1
Sequence length 573
Comment (tr|I1GNL1|I1GNL1_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI1G09500.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=LOC100837729 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MAIIQARTWVVFLLLALLSPSWPVAEASHHVSPDLQSLDAGLAADALRTGYHFQPPMHWI
NDPNGVMYYKGVYHLFYQYNPKAAVWGNIVWAHAVSTDLVNWVMLEPAIYPTAPFDVNGC
WSGSATVLPDGRPAIMYTGIDGDGRQVQNVAYPKDLSDPYLREWVKPDYNPVIPPGSGVN
ATAFRDPTTAWLGPDGLWRLVVGTKDNHRGLAVLYRSRDFQSWAPAEGGPLHHGDTGMWE
CPDFYPVGDGAQTKHVLKVSLDLTRFEYYTFGSYDHANDTYVPDAALADGERGLRYDYGN
FYASKTFLDTANKPRRVLWGWANESDSTADDVRKGWAGVQAIPRKLWLAPDGKQLMQWPV
AEVESLRGNHVNITDRLVEAGSYFEVQGLMIPAQADVEVSFAVVGGLDKAEPFDPAWRGA
DAQTVCAARGADAEGGVGPFGLWVLASDQLKERTAVFFRVFNDDGKHVVLMCNDPSRSSY
ADHLYKPTFAGFIDVDLAKTGGKIPLRTLIDHSMVESFGGHGKMSILSRVYPTQAVGDKA
RLYVFNNGETDVKVTHLNAYDMRSAKISTEIDR
Download sequence
Identical sequences I1GNL1
15368.BRADI1G09500.1 EG:BRADI1G09500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]