SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1HNP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1HNP9
Domain Number 1 Region: 19-244
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.17e-40
Family DnaQ-like 3'-5' exonuclease 0.0019
Further Details:      
 
Domain Number 2 Region: 267-330
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1HNP9
Sequence length 332
Comment (tr|I1HNP9|I1HNP9_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK08359.1, ECO:0000313|EnsemblPlants:BRADI2G41400.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_2g41400v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MASHPPNPTDGDVPAGNNSELPSLPFHVVTKPGQLPVEFLEPSAAHKLVIGFDCEGVDLC
RNGALCIMQIAFPDAIYLVDAIEGGKELIEACKPALESEYVIKVIHDCKRDSEALYFQFG
IKLHNVMDTQIAYSLIEEQEGKKRAYDVYISFVSLLADPRYCGMPYPEKEEVRTLLRQDP
NFWKNRPLSEMMIRAATDDVRFLLNIHEKMMEKLSKVSLWRLAVRSELYCRCFCINDNQY
ADWPPLPTVPDDFEAEVHVPEVDILSLLDVPPGKMGRVIGRKGSSIMAVKESCNVEIHIG
GAKGPPDRVFIIGPVKEVRKAEAILRGRMLEF
Download sequence
Identical sequences I1HNP9
EG:BRADI2G41400.1 15368.BRADI2G41400.1 XP_003569227.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]