SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1HYZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1HYZ4
Domain Number 1 Region: 879-1052
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.17e-50
Family Motor proteins 0.0001
Further Details:      
 
Domain Number 2 Region: 40-121
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000084
Family Calponin-homology domain, CH-domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1HYZ4
Sequence length 1079
Comment (tr|I1HYZ4|I1HYZ4_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI3G08710.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN= OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MEAIDGVATGASRSAAGAALGGRRSVRGGWGTGPAAAARRRADAVGWLREIFPDSPLPPP
SDASDADLHAALAGGRLLCALLRKICPGALLDDASTDNVGRFRAAVERMGVPTFSAFDLE
RVCFPANCSFGVYCRDAKLLILVDIGADASIQGGQMSSVVACILALKDRYGSRADEDQSF
SFLTRCDSEGSRRHMEAKLQRVLTSPVMSEPSSPSLGANLYTPSGVFQMKQGGYADLPGC
KISDLMKSSSLDNAPTQSLLGVVNSIVDESIERKNGQIPYRIACLLRKVIVEIERRMSSQ
AGHIRNQNNLIKAREEKYQSRIRVLEALAGGASAQAHMENDKLKDKGQQPEEDIARLMKC
QEEIVRLMKEKEDMVKLLREKEDMVRLLKEKEDMVRLLKEKEDMVDLKKVKVEETRRIAD
EEKDRLLKQKDDIVVRLTKEKQEMVRLLQEKEDMVSLLMAKEDMVDVKKVIVEETQRITD
EGKDVLLKEKDDTVARLTKEKEEVVRLLKEKEDIIRVLKENDHMDRSIEKEDTIKLENWS
SKDKKQKADDDNDQLIKENNAIVVRLTEEKEEMIRLMKEKEDRIRLTKDKEDLFMSMKEK
EDKVDLKKGDIVNMKQSTDEDADMSVKENTDIIRLMKEKEDSKNTIMKLKLELEALKSSH
EENCKLLESKKEDIVKLLADKEHNASIILQLRQDESTKENNDIIRLMKEKQDDNNIIMKV
KLELEALRSSYEDGCKLLQSKEADVVKLLADKEDSASLILQLRQEIEATKGLHETYSQQL
EMRAAKVKEELEERIKEVELMLEDSIKRRREVEELSKSRILFLEQKEIVVNQILGLQIQH
VQDLRLSSVSVRHEILNCQKRWLEELAGLGQNLKVVTNTAEKYHAALAENRKLFNEIQEL
KGNIRVYCRIRPFQRGEDERSSSVEYIGDNGELVLSNPTKQKEGSKNFTFNKVFGPTTTQ
DMVFKDIQPLIRSVLDGYNVCIFAYGQTGSGKTYTMMGPENATEKEWGVNYRALNDLFNI
SHDRQDTIMYELSVQMIEIYNELIRDLLGGGGVQKKYPFCPKLHYYRLPLGCRLAIFLP
Download sequence
Identical sequences I1HYZ4
EG:BRADI3G08710.1 15368.BRADI3G08710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]