SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1I4B2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1I4B2
Domain Number 1 Region: 346-674
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-79
Family Protein kinases, catalytic subunit 0.0000975
Further Details:      
 
Domain Number 2 Region: 22-278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.79e-60
Family Legume lectins 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1I4B2
Sequence length 701
Comment (tr|I1I4B2|I1I4B2_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQJ96881.1, ECO:0000313|EnsemblPlants:BRADI3G27590.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_3g27590v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MLPKKLLLLLQLLAQLLVAGGVDFAYEGFAGGGTRQLSLDGMATIMPDGLLLLTNDTNMS
KAHAFHPDLVTLRPALPTAPGTTAVPTATMSSFSTTFVFAIASDLVGLSTSGFAFLVVPG
NARDALASAMPAQYLGLFNTSSNGDPRNHVFAVELDTVRNPEFGDMDDNHVGLDINSLNS
SVAATAGYYDDDAGVFRNLSLASREPLQVWVDYDGATTEIAVAMAPAGSPRPKRPLLSTR
IDLSTVIAADTAYVGFSSGSSIVLCRHYVLGWSFSTGGAAAPPLDHAQLPKLPRVAGPPK
PPRSRATLAIALPIMTTTAVLAAVAVGVLVHRRRLRYAELREDWEEEFGPHRFAFKDLHD
ATGGFKDKRLLGAGGFGSVYMGALPGSRTQVAVKRVSHESRQGVKEFIAEVVSIGRLRHR
NLVQLLGYCRRKGELLLVYDYMPNGSLDKYLHGDGDGGSKPATLGWAQRLRIIKGVASGL
LYMHEDWEKVVVHRDIKASNVLLDAEMNGRLGDFGLARLYDHGADPHTTRVVGTMGYLAP
ELMRTGKATTLSDVFAFGAFLLEVACGRRPIEEGDEEDVYGDVERFVLADWVLGHWRNGA
IAGAVDAELRAAGVYDAAEADLVLRLGLTCMHPSPAARPSMRQVMQYLDGSTPLPELPPT
YVTFNMLAAMETHQGVLRSLSIWRAASSVATISDIGVDSGR
Download sequence
Identical sequences I1I4B2
15368.BRADI3G27590.1 EG:BRADI3G27590.1 XP_003571823.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]