SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1IFY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1IFY2
Domain Number 1 Region: 571-877
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-69
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 95-183
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000131
Family alpha-D-mannose-specific plant lectins 0.0096
Further Details:      
 
Weak hits

Sequence:  I1IFY2
Domain Number - Region: 402-431
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0051
Family Pan module (APPLE domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1IFY2
Sequence length 929
Comment (tr|I1IFY2|I1IFY2_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQJ85553.1, ECO:0000313|EnsemblPlants:BRADI4G00206.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_4g00206v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MALPPPLRLLLQLLVVFLGTGGPLTAARTVPVEFLYPPFNLTYMHYIDTNGVFLLSGPNG
TFSAAVYNAGSGGGSSFDSQSRFFFSVLHDKSRTPVWTATAGSTILQSITLSLTAKGMAL
SYPADPDPAWSTPPLAAPVASLRLRDTGELALLDAANATLWSSFDRPTDTLLQGQRLPVG
ATLTASASDQDLSPGPYRLLLTPNDALLQWAPASSSSAPANASSLVTYWALSSDAGAVQD
SNLKVESMAVNASGIYLLAGNGRDTVLRLLFTPPPSSSSAKVLLKVGSSGRLRVLSMAIS
PTAARASLPSVWEAPGNDCDLPLPCGSLGLCTAGTGSNSSCMCPEAFSTHTTGGCSPADG
STTLLPTDDCANGSSSSSYTGLGDGVGYFASKFAVPATAGGALPACRDLCSANCSCLGFH
YRNSSKSCFLMLNQIGSVFRVNADSFSSTAAAVFIKTVPAASRGHGRGSSRLSSITIVFG
VVLPTVAAVFIAFLLYVMAKHWLNKRGGSNGQKKKKKKKKKKTKHESSEGWRRSWFMLHV
MSSSRASSNVPSEKDTEEDSEEEDDDPDAVLIPGLPTRFTFDELEAATNGFKRQIGSGGF
GSVYRGSLPDGTTVAVKRMNNLGTQGRREFLTEIAVIGNVHHVNLVKLRGFCAEGPQRQL
LVYEFMSRGSLDQSLFVSSNSGLAWPERVGVCVGAARGLAYLHSGCHRKILHCDVKPENI
LLDGRGGVKIADFGLAKLMSPEQSGLFTTMRGTRGYLAPEWLMNAPITDKADVYSFGMVL
LEIVRGRKNSKLLDDTGTSSGASDDGGKEERSRGYFPAMALAVHEEEASPGYSELADPRL
EGKVDAGEVSRVVRVALCCLHEEASLRPGMTAVAAMLDGSMEVCAPRTDQLSYLRMYGRA
GTTAGAGAASSSTWSPPSCVSAQQLSAPR
Download sequence
Identical sequences I1IFY2
XP_003579074.1.954 EG:BRADI4G00206.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]