SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1NTK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1NTK9
Domain Number 1 Region: 21-137
Classification Level Classification E-value
Superfamily PX domain 9.16e-34
Family PX domain 0.00039
Further Details:      
 
Domain Number 2 Region: 183-395
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000101
Family BAR domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1NTK9
Sequence length 399
Comment (tr|I1NTK9|I1NTK9_ORYGL) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORGLA01G0319900.1} KW=Complete proteome; Reference proteome OX=4538 OS=Oryza glaberrima (African rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MSQERSQSQSPRSPASAAGVPFLSISVTDPVKMGTGVQAYISYRVITKTNLPDFEGQEKI
VIRRYSDFEWLHDRLAEKYKGIFIPPLPEKNAVEKFRFSKEFIELRRQALDLFVNRIASH
PELKQSGDLKIFLQADEEKMDRERSYETGIFKKPSDFLQMFKDVQSKVSDVVLGKEKPVE
ESSPEYEKLKNYIFELENHLAEAQKQAFRLVKRHRELGQSLADFGKAIKLLGACEGDSLE
KVFSEVGSKSEMLSVKLQREADNLLFNFEEPLKDYVRAVQSIKATMVDRANAFRQHHDLF
QQKEYKGVNLEKLKFVNPDKFSELEAEVRELTADSEEATKRFEHIVAVMNEELARFQEQK
TADIGFAFHEFAKGQAKLAKDIADAWRGVLPKLEACSTS
Download sequence
Identical sequences I1NTK9 Q5N7G9
39947.LOC_Os01g64280.1 ORGLA01G0319900.1 XP_015620548.1.37577 LOC_Os01g64280.1|13101.m06919|protein LOC_Os01g64280.1|PACid:21909473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]