SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1PCD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1PCD1
Domain Number 1 Region: 505-800
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-77
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 61-203
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.49e-29
Family alpha-D-mannose-specific plant lectins 0.0043
Further Details:      
 
Weak hits

Sequence:  I1PCD1
Domain Number - Region: 340-386
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000785
Family Pan module (APPLE domain) 0.022
Further Details:      
 
Domain Number - Region: 214-283
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00144
Family alpha-D-mannose-specific plant lectins 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1PCD1
Sequence length 834
Comment (tr|I1PCD1|I1PCD1_ORYGL) Serine/threonine-protein kinase {ECO:0000313|EnsemblPlants:ORGLA03G0202700.1} KW=Complete proteome; Reference proteome OX=4538 OS=Oryza glaberrima (African rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAPFFSILPALSFLALLPIVMSRDKIPLKSSLSVDDYQNDVLQSADGTFSCGFLTIYSNA
FAFSIWYTNSKNKTVVWTANRGRPVHAKRSVVTLQKDGAMVLKDYDGTVVWQSDSNSIDV
QYAQLLDTGNLVMKNSSGKVVWQSFDSPTDTLLPTQKITAATKLVSTTGLYVPGHYTFHF
TDSSILSLMYDDADVHEIYWPDPDRGEYGNKRNRYNNTRMGFLDDNGDFVSSDFADQQPF
SASDKGSGIKRRLTLDHDGNLRLYSLSNGEWLVSWVAISQPCNIHGLCGPNGICHYSPTP
TCSCPPGYEMNSHGNWSQGCKAIVDISCSVAKVQFKFVHLPDTDFWGSDQQVVKPVSWQA
CMDICRSDCNCKGFQYLKGEGTCFPKSFLFNGRAYPSHFVSPRNMYLKIPISMNISGMPV
SQSNVLDSRKHSLNCDQMDEKTRELFPDVHKTSQGETRWFYLFGFAGAIFILEVFFIGFA
WFFVSRWDLDALEIQAVEQGYKVMASNFRRYNYKELAKATRKFKCELGRGGSGIVYKGTL
DDGRVVAVKMLENVRQCEEEFQAELRIIGKINHMNLVRIWGFCSENSHRMLVTEYIENGS
LANILFNENILLEWRQRFNIAVGVAKGLAYLHHECLEWVIHCDVKPENILLDGNFEPKIA
DFGLAKLLNRRGSNQNVSRVRGTIGYIAPEWISSLQITAKVDVYSYGVVLLELVSGKRVL
DLATSANEEVHVVLRRLVKMFANNLSGNEPSWIAEFVDCRLSGQFNYTQVRTMITLAVAC
LDEERSKRPTMESIVQLLLLVDESCSSNVLCPEMPTRWTTGHAKANASFCIHSL
Download sequence
Identical sequences A0A0D3FJY4 I1PCD1
OBART03G21810.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]