SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1PYK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1PYK4
Domain Number 1 Region: 112-227
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000101
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Weak hits

Sequence:  I1PYK4
Domain Number - Region: 76-110
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0392
Family Mitotic arrest deficient-like 1, Mad1 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1PYK4
Sequence length 250
Comment (tr|I1PYK4|I1PYK4_ORYGL) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORGLA05G0245200.1} KW=Complete proteome; Reference proteome OX=4538 OS=Oryza glaberrima (African rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MDDVYGRIEVFPQHFLPSQQSMETPADGLSTSKTNLDSPPSSRRRSWTPKRVMGAASLLH
LLSLPRIRWSSSTEDDDKIELTRAEVESLRTEIADAEERESQLKARLENIDEVLRYARLS
GYLYIRSRWTQLPGEPPILDDADVDDWLPRFVVLQGQCVYYYLKSTDLSPQESTLLCDIV
EVGQLPNFVPEDEKTRYAFYIMTSQGLKFECSSMSEIQVDSWVRAIRGDCGLSDGGESRS
KTSRQEVGSW
Download sequence
Identical sequences A2Y866 I1PYK4 Q5KQH1
LOC_Os05g51710.1|PACid:21942620 ORGLA05G0245200.1 XP_015639334.1.37577 LOC_Os05g51710.1|13105.m05590|protein 39947.LOC_Os05g51710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]