SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1QBV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I1QBV3
Domain Number - Region: 25-198
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0502
Family FCH domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1QBV3
Sequence length 608
Comment (tr|I1QBV3|I1QBV3_ORYGL) FRIGIDA-like protein {ECO:0000256|RuleBase:RU364012} KW=Complete proteome; Reference proteome OX=4538 OS=Oryza glaberrima (African rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MATEDTSHISGSSESTIPLLEQLAEVFGKLKSHTETSLQLQNGINWEDIKAHFLNLEKSY
KSKCDELAEKQKALEEKKAESCRLIAEKEANVSAKERAFLNQFQELRDTAVSALSEVRQK
YKVELAGILDANGSKDKKVRTSTNDMNALCASEENTTASGLGEPSEASPVDVKPRPVLKQ
LCEQMDTAGLLKFLSENWKKLSSLRDELSAALRCATDPARFVLGSLEGFFPSDHTSSPGN
KQIILQGQRRSCIILMEAITPALATKEPGDNHPWSSEIRELAKAIAEEWKSKLAEVDLDA
SDGYSLEAQAFLQLLTTFNVDSVLDEDELCKLVVAVSRRKQTAELCRSLCLNERIPDIIK
ELVNRHRQIDAVQFIHAFGLSESFPPAPLLKTYVEELKDSLGNNGDGNAASLKDDPKTRE
LLALRAVIKCIEEYKLQKDYPLGPLQKRVAELKSKGEKRPLEAGRHNAKKPRTFGNSAAR
RPPNPVGSAGRRPSGPAGTWQRPPPPMPSYPDRYGHADRYHYTAPSATYDPPAYASYSEP
YSASKPYQYTPGSVAPASYNSNQFKVAYGGPGAPPTAGGYGSYNDAAGQSTSSSYSGYSG
YHPSLPRL
Download sequence
Identical sequences I1QBV3 Q7XIP0
ORGLA07G0159500.1 XP_015647752.1.37577 39947.LOC_Os07g40270.1 LOC_Os07g40270.1|13107.m04185|protein LOC_Os07g40270.1|PACid:21900636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]