SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1Y741 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1Y741
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.19e-29
Family Duffy binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1Y741
Sequence length 171
Comment (tr|I1Y741|I1Y741_PLAFA) VAR2CSA {ECO:0000313|EMBL:AFI97727.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var2csa OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
EYTKDLELNLQKIFGKLFRKYIKKNISTEQHTLYSSLDELRESWWNTNKKYIWLAMKHGT
TCSSGSGDIGDGSVTGSGSSCDDIPTIDLIPQYLRFLQEWVEHFCKQRQGKVKDVIENCK
SCKNTSGERIIGGTCNSDCKTKCKGECEKYKNFIEDCNGGDGTAGSPWSKR
Download sequence
Identical sequences I1Y741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]