SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1Y806 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1Y806
Domain Number 1 Region: 5-180
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.81e-24
Family Duffy binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1Y806
Sequence length 180
Comment (tr|I1Y806|I1Y806_PLAFA) VAR2CSA {ECO:0000313|EMBL:AFI98042.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var2csa OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
VGNLWYKSYGGRSNIKNDTKESLKQKIKNAIQKETELLYEYHDKGTAIISRNHMKGQKGK
NDPNGLPKGFCHAVQRSFIDYKNVILGTSVNIYEYIGKLQEDIKKIIEKGTTKQKDKIGG
SGADKVNDWWKEIEKDMWDAVRCAITKIKKQKKNGTFSIDECGIFPPTGNDEDQFVSWFK
Download sequence
Identical sequences I1Y806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]