SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I2CIX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I2CIX3
Domain Number 1 Region: 590-929,968-987
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.32e-78
Family Duffy binding domain 0.00022
Further Details:      
 
Domain Number 2 Region: 1381-1452,1486-1562,1589-1766
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.54e-73
Family Duffy binding domain 0.00013
Further Details:      
 
Domain Number 3 Region: 994-1356
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-71
Family Duffy binding domain 0.00022
Further Details:      
 
Domain Number 4 Region: 1-281
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.29e-53
Family Duffy binding domain 0.00064
Further Details:      
 
Domain Number 5 Region: 2093-2395
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.72e-51
Family Duffy binding domain 0.0003
Further Details:      
 
Domain Number 6 Region: 1758-1970
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-40
Family Duffy binding domain 0.0022
Further Details:      
 
Domain Number 7 Region: 272-481
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.66e-25
Family Duffy binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I2CIX3
Sequence length 2400
Comment (tr|I2CIX3|I2CIX3_PLAFA) EMP1 {ECO:0000313|EMBL:AFJ66673.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
GDIVRGRDMFKRNNHDNVENGLREVFKKIHEDLSPEVQKHYKDDGSVNYYKLREDWWNAN
RDQVWKAITCKAPQGADYFRKGSDGSNLFSNNGPCGRNETDVPTNLDYVPQFLRWFEEWS
EEFCRKRKIKLEKIKNACYNKEKKIYCSHNGYDCIKMSWKKDIESREYYCTGCFSACSLY
KIWIGKQKEEFEKQKEKYKNEIQKYVSETVRSNSTINNEYYNVYKNFNENNYETNNNFLN
LLNEGKYCKEKLQGEENVDFTKTGEKGIFSHSKDCKVCPYCGLVCVGTECTAKEEIYPDC
VYNGEYDPPKDVRPTEINVIDSGNEVDISKKLSEFCSNENKENIENYQKWKCYYTNSEDI
DCEMTSISQKDQKISDVKTFYNFFDLWVKNLLRDSIKWETELKGCINNTNVTDCKSVCNV
NCECFDKWVKQKEKEWDSIKKLLKKKKNVSKKCYTNINKNFDIFFFRVMYELNNEEAKWN
KLMENLRTKINSSKKNKRTKDSEGAIKVLFDHLKETATICKDNNTNEACVSSQNATTNPC
AKSRDYNKHATVKQIAQYYKRKAYIQLNERAGRSALKGDATKGKYMSSLSEKRLYEICKI
TKDNSNAKREFSKHPCAGKDREKKLFELKDVWKTGTDVQMSHKDVFMPPRREHFCTSNLE
FLDTDYIPFIYYGAKVINDSFLGDVLLSAKSEADKIIDMYPKNNGQNDKEGICRAIRYSF
ADIGDIIKGTDLWEANPGEKNTQRRLETVFGKIKKQFNGKYTHEEAKPPYRQLRADWWEA
NRHQVWKAMKCAIKEFNDTSVSTQSNGYCGYSDHTPLDDYIPQRLRWMTEWAEWYCKMQK
EEYEKVQHACAKCNVVDGKCTQGNGECANCATKCKQYAQNVKKWEDQWKEIKQKYYELYQ
KATQNDDTSSNKDVDVVKFLSELYKANNVKSGANSDMYGTAAGYVHQELPSMECNTQKIF
CENPTSADDNKNYAFALYPRDYKEKCNCKDDTPTQEKKKDDVCQIVNELIGNDNGQNLIG
RCNQKYNRGKGNYPGWNCDSEIDETHKGACMPPRRQKLCIYYFGNPNETRNIQTQENLRK
AFIKSAAGETFHSWQYYNSKNDNDAKLLDSGIIPPEFLRSMFYTFGDYRDFLFGKDISKK
HGEKSNLKKQIDTLFPTDGRTQNGLSREAWWQNYGSHIWKAMLCALEKIAGNKDKLTGHQ
SKYQYNSVKFSDNRNGPDLETFAKRPQFLRWMTEWGDEFCRERKKKEAKVKEYCKKEYEG
CEKDKNVTACAKACEEYKKYITDKNSEYTNQEGKFKYDKSQKKQGYNDISNDDASEYLKD
KCLDSQCNCMDKVHTISNYWETPHTTYDDNSLQKKCSCPPPPCEIVDAILGDKSSMGYRE
GCRKKYMTRGTGWLCDDKEGGNEDGDICIPPRRQRLYVKDLETFTGETQIQLREAFIKCA
AIETFFAWHEFKKEKEKEDKENNEEKYLIGQQNTMDKVLQEKLESGQIPEEFKRQMFYSF
ADYRDILFGKNIGKDDGKLNEKIKSAFANDGKTSSVKTTQEFWDKYGKDIWEGMLCALSY
KTDIQRMDPDVRAKLTTDKKNTYDNVTFKGGFNSSNTKLDKFASRPPFFRWLEEWTDEFC
RKKKIKIDKIIEDCRGKYGNRYCDGDGFDCTEIVPNKEGTIRTFNCPSCGKCCRSYKEWI
SRKKDEFDKQEKIYQKKIEGSKRYSDNIYDKQFVQTLDEKYRSIELFLETLKEGPCFNNK
SDHSTINFIERNKTFEHSKLCAPCPVFGVKCKNRVCGDDTVENCKGKTIITRNNIGEMEK
SIEVDMFVIDNSTKGFADHLGNDCKDTDIFKDIRQDKWECGYFCNSDVCVLKNLEGTDDK
QNIQIRTFFKLWIENFLKDYNKINEKNSHCMKNGEGTKCIKGCYKNCECVSIWIEKKKEE
WEKVRKRYFDQYSVDNSRKSFTVKSFLENLQPQTEVQKAIKPSNDLDELQNSSGCTDSNP
LKKNDCENNDVITILLNKLKKEITSCKEKHDETPPNTCDDFPPQTYIEPLDDDTTDIEKP
LFCPTEEEKEETLCDSKNQPKCDGYYAYNSNTYEPKTNLIGLGAQYHKAGRFYPNVYVPP
RVRQLCLQPLKELKEVNKNTSNVSELIEAFTKCAYNEGKGLYKYYAKNKSELGKNGSPLS
DEEVKTYTLEAMKRSYADYGSIVKGDILWDYEKKDQIDLKIIDFAKNHKSTTTSSVSTSD
DDDVKRQNLWELIKTHVWKAMLCGYKTAGGNMNSLPNGGEFCTLPSTDEEDQFSRWFVEW
GENFCIRHEKELKQLKDKCEKGICDGKDESKKQTCQTLCKKYQEFLINSKIQYETQKPEY
DNLMSSIPKHRKKDAIEFLKEKCNPQFSCFKDINENELNNIFHYPSDEIIKFCTCTSKDT
Download sequence
Identical sequences I2CIX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]