SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I2CWU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I2CWU8
Domain Number 1 Region: 263-323
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.55e-18
Family Erythroid transcription factor GATA-1 0.00043
Further Details:      
 
Domain Number 2 Region: 211-261
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.08e-16
Family Erythroid transcription factor GATA-1 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I2CWU8
Sequence length 442
Comment (tr|I2CWU8|I2CWU8_MACMU) Transcription factor GATA-4 {ECO:0000313|EMBL:AFJ71433.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=GATA4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAG
SASGGAAGGSSGAAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAA
AAAAAAREAAAYSSGGGAAGAGLAGREQYGRAGFASSYSSPYPAYMADVGASWAAAAAAS
AGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNA
CGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMK
LHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPAGSESLPPASGASSNSSSATTSSSEE
MRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSLHPVLSALKLSPQGYVSPVSQSPQT
SSKQDSWNSLVLADSHGDIITA
Download sequence
Identical sequences I2CWU8
9544.ENSMMUP00000025243 ENSMMUP00000025243 XP_015000236.1.72884 ENSMMUP00000025243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]