SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I2H184 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I2H184
Domain Number 1 Region: 103-339
Classification Level Classification E-value
Superfamily vWA-like 1.05e-25
Family Trunk domain of Sec23/24 0.0005
Further Details:      
 
Domain Number 2 Region: 557-657
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 0.000000000107
Family C-terminal, gelsolin-like domain of Sec23/24 0.0034
Further Details:      
 
Domain Number 3 Region: 26-81
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.000051
Family Zn-finger domain of Sec23/24 0.0065
Further Details:      
 
Weak hits

Sequence:  I2H184
Domain Number - Region: 501-538
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 0.00209
Family Helical domain of Sec23/24 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I2H184
Sequence length 658
Comment (tr|I2H184|I2H184_TETBL) Uncharacterized protein {ECO:0000313|EMBL:CCH60136.1} KW=Complete proteome; Reference proteome OX=1071380 OS=NBRC 10599 / NRRL Y-10934 / UCD 77-7) (Yeast) (Kluyveromyces blattae). GN=TBLA_0C03330 OC=Tetrapisispora.
Sequence
MSYDSSKNIHCIFQPFIKEEDDFIEKTSFAIIKCENCSSTFHNFQNIEGTSHQYNWVCEF
CQSKNSIGTEAKLQDLNLPNSYTAELVSRSKTNSTHIREKRSIFVIDCLTNEIELETLKL
VLNNPEALPEGKYALITIEPKGNVVINLSSGKTVPFSIEQSKIEKAVKNLDDEFFLKHIT
VGAAWFDSKITFTRKIKTLKPFAKKETARAKKRPKRATGLALFLASVLSPHKNCNTHIMS
FLSGPCTIGPGKVASTDIKKPIRSHDQLDSGRDKYFIKTTTFYEEFNAYCLDNICFDFFI
SSLDQTGLLEWKSLLTSSMSITQFDSFNDEKFTESWRNYIKLRNEFALELASLKILSTSG
IVFKNNLIADIKFQPTKTKNERINEMKWKFNKPLVLNPKNFVIPCEFEVHSGTLQTIQFQ
LHYYKDDQSYIKIVTIPFKLIQPWKNGFHIEIEIPFLLKKFAQQILLKTIYDTSTMSEYL
AAEIDMYEKNLPTLSDRDLKLFYQLQRSTILLKRNTSPDEHILLAHYLYNSSTSNCLFTC
NPLMIKFPNDKSIKGKTDLIPLDARFATDSHSLFVDGGVFIMVRYTEETDDTVKAKDMAM
TIIKSVERYPKPRFIYTMVGKSQDRFFKSKLIPLTEEESVELGTQDLPFEKFTQHVHK
Download sequence
Identical sequences I2H184
XP_004179655.1.8396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]