SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I2K1P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I2K1P9
Domain Number 1 Region: 87-173
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000019
Family UAS domain 0.074
Further Details:      
 
Domain Number 2 Region: 267-348
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000103
Family UBX domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I2K1P9
Sequence length 437
Comment (tr|I2K1P9|I2K1P9_DEKBR) Secretion lowering protein {ECO:0000313|EMBL:EIF49151.1} KW=Complete proteome; Reference proteome OX=1124627 OS=Brettanomyces bruxellensis AWRI1499. GN=AWRI1499_0907 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Brettanomyces.
Sequence
MAVTEDSQFXPPIVFVLMVIPKLLWALGWGLDRXLGSTFPKLFHFLGFRDGPGDFPLKPM
HETKEEISTYNVKDXIDNTLGETSDLHIFKGEFNEAFXDAKGGLKWMMCILIDSQSDVSR
KFIKTYLNDSHFLELLKKHDVILYIGDVQYPEPHEVGSTYRAYSIPYLXIIGNVSSSDIS
APSMSIVFKCQSFGKDSKQTPEGRRKYFRRMNRAFDRYEPQLVAQRADKEEAXFARXLRE
QQDSAYQKSLLRDEKKHAEKEKRLREEQQKKEEVKRIEEAKELEAKQRKAFLLRYIREKY
TRDTTTWXAGSYTRIQIRDDKGKRNVWKFDKNDTXYDLFMFVETXRYLFQLAKKXGKDEG
EVKAIIESEXVPNIDTRDYQLSFTFDLISPLNRLRLTADRQKLIHTCDYLWPNGSLLVEK
ADDXSSDNTDSTTEEDD
Download sequence
Identical sequences I2K1P9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]