SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3IUV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3IUV5
Domain Number 1 Region: 367-553
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-61
Family SPRY domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 14-83
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-19
Family RING finger domain, C3HC4 0.0095
Further Details:      
 
Domain Number 3 Region: 151-215
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000458
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3IUV5
Sequence length 569
Comment (tr|I3IUV5|I3IUV5_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000000395} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100694728 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MSTQTVTNMASVPLENQFRCCICLDTYTDPVSIPCGHNFCLDCIEGYWDTKDRSECPLCK
ETFKERPELRINRAFSDMIEFFKRSLSPTLMQGEDVEPAHQLSDREDVPCDVCHGNKAPS
VKSCLVCQASYCEIHLVPHQRDPALQRHRLTDPAIFNTSHLCRKHNKPLTMFCKQDHTPV
CSKCTEGDHKHHKIVPMEKESRRVKMNLRETKSDIQQMIQARLKKMEDIKSSVDLSKRAT
EREIQSSSQVCSTLITAIERQQAELAKDLEERQLEAERKAEELLEELEKEIHELQTRSSE
LQHLELTRSSLHLLQSFPSLSRLPATREWSEVAVHSDNSAGMVRRAVSMLGDMCQEVANK
LSAEEVDKISAYAVNVTLDPETASGWLVLSPDKKKVSLASQKKKTPLPDSPQRFDSCVCI
LGKQSFTSGRRYWVVQVGDKTDWDLGVAQESINRKGAITVRPENGYWAICRRKGGSLSAC
AGPSVTLNLHEIPKKVSIFLNYEEGSVSFYDAEAKTHIYTYGGCSFSEPLFPYFNPCVQN
SGRNVAPLVICPLEGDVREEQDTGIDLTV
Download sequence
Identical sequences I3IUV5
XP_003458820.2.78416 ENSONIP00000000395 ENSONIP00000000395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]