SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3IVT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3IVT7
Domain Number 1 Region: 175-209,238-464
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-73
Family Nuclear receptor ligand-binding domain 0.0000000099
Further Details:      
 
Domain Number 2 Region: 126-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.22e-25
Family Nuclear receptor 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3IVT7
Sequence length 465
Comment (tr|I3IVT7|I3IVT7_ORENI) Estrogen-related receptor gamma b {ECO:0000313|Ensembl:ENSONIP00000000727} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100695726 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MDLVDLYLPECFTYHSDTEHLDRMSVRGLDPTCPSSIKREPSSPSPSSQGDVSPAQPSPG
SSSSDTNSSYGPLTKGHNHNNGQDSPGLFSHTAGLASNGGANRLVRFGEEEGQVKCEFML
GSVAKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGNIEYSCPASNECEITKRRRKSC
QACRFVKCLAVGMLREGVRLDRVRGGRQKYKRRIDAENSPYLHPQNALPQKKTFSVGGVV
ENKVVSLLLVAEPEGIFAMPDPTVPESDIKALTTLCDLADRELVVNIGWAKHIPGFPSLS
LADQMSLLQSGWMEILILRVVFRSLALEDKLVYAEDYIMDEEQSKLAGLLDLNNAILQLV
KKYKAMGLEKEEFVVLKAIALANSDSMHIEDSEAVQRLQDVLHGALQDYETIHHPEDPRR
AGKMIMTLPLLRQTAARAIQHFCSIKQDGRVPMHKLFLELLEAKA
Download sequence
Identical sequences I3IVT7
ENSONIP00000000727 XP_005449658.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]