SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3IVU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3IVU5
Domain Number 1 Region: 293-353
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000124
Family UBA domain 0.0095
Further Details:      
 
Domain Number 2 Region: 18-197
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0000000000275
Family Rhomboid-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3IVU5
Sequence length 353
Comment (tr|I3IVU5|I3IVU5_ORENI) UBA domain containing 2 {ECO:0000313|Ensembl:ENSONIP00000000735} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=ubac2 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MFTTTGSRGLYKAPLSKSLLLVLNGLTVMLTLLPRYQDLFVYHLQAITQEHQVWRLLCGR
LVCLDIKDSFCSSLLIYNFRIFERRFGTRKFASFLFGTWCLSALMDFLLAKAFQFLFDYE
LEELPSGLLAPVFSLFVPFYLSIPRMPVTQVLGRIHITNKSLVYIVGLQLLTSSPFMWLL
ALSGLISGGLYHSSVLRLQKILFVPAWVSRIGQYILEPVFSSSQPTSETPLGMGATLDVQ
RQQRMELLDQQLLLAQYNEARRNARQQPQSGLLQWTRLFPSLRHRGQNRVPVQPRPQPQE
HQSTQPPSLDNSPVAEEQVARLVEMGFSRIDALEALRASNNDINMATNFLLQH
Download sequence
Identical sequences I3IVU5
ENSONIP00000000735 XP_003438338.1.78416 ENSONIP00000000735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]