SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3IWF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3IWF3
Domain Number 1 Region: 26-188
Classification Level Classification E-value
Superfamily RUN domain-like 2.22e-44
Family RUN domain 0.0000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3IWF3
Sequence length 433
Comment (tr|I3IWF3|I3IWF3_ORENI) RUN domain containing 3Aa {ECO:0000313|Ensembl:ENSONIP00000000943} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100703962 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MESGCIQTAMAMGLTSKKASARSVCVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFIN
FAAILEHILSHRFKGSGSWFSSDGQRSFWEYIRLACSKVQNNCITSIENIENISTSRAKG
RAWIRVALMEKRLSEYVSTALRDTRTTRRFYDDGAIMLREEATVLTGMLIGLSAIDFSFC
LKGETLDGKSPAVIDYTPYLKFTQSYDYLSDEEDRRSVDSSNSEESVPEHPYIPLVTDEE
SWSNKCRKMEQRFKIVYAQKGYLEELVRLRESQLKNVETENKRLRAKVEELTVQSQQEKK
ELEAIVLELQAQLSALMPCDSSHLAKDLSIPLINQWSTITNNQGDVKLFRRRSFHSLEQL
SAEVSLNSDSQKTDGRQNGDAAWTSAGKDNTPSMLGLCGSLASLPSSKSLASLKSSECLV
NISTEPSPALSPS
Download sequence
Identical sequences I3IWF3
ENSONIP00000000943 XP_003442039.1.78416 ENSONIP00000000943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]