SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3IXK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3IXK9
Domain Number 1 Region: 367-550
Classification Level Classification E-value
Superfamily Kelch motif 6.54e-28
Family Kelch motif 0.0019
Further Details:      
 
Domain Number 2 Region: 72-205
Classification Level Classification E-value
Superfamily POZ domain 2.47e-25
Family BTB/POZ domain 0.0044
Further Details:      
 
Domain Number 3 Region: 600-667
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000248
Family Kelch motif 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3IXK9
Sequence length 716
Comment (tr|I3IXK9|I3IXK9_ORENI) Kelch-like family member 11 {ECO:0000313|Ensembl:ENSONIP00000001349} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=klhl11 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MCRQVGMAAGTPFTQCASSLLHFPPLLTSSAGSRMAAAAPNPEDSTRSSGSSGTSTPSAL
AGDGDAEEAEEFTSSSHCSELSRRQNEQRKQGLFCDVTLAFSSGAATGSVQSCEFSAHRS
VLAAATDYFTPLLGGQFSESLSGRVEMKEWSSELGPDPETVESVIQYMYTGEIRVSTCNV
HEVLELADRFLLLQLKDFCGEFLKKKLSLTNCVAVHSLAHMYTLDQLALRAADMIRRNFH
KVIQDEEFYTLPFHLVRDWLSDAEITVDSEEVLFEAVVKWVQKNPEERSRYFEELFRLLR
LPQIKPTYLTRVVKNERLVASNEACLRLVSEAVEGHAIRFENLKSADMEFWSSHMASFQP
RFGQNMDVIMVVGGVSEGGDYLSECVGYFIYEDRWVNLPHIHNHLDGHAIAATESHVYVA
GSMEPGFAKTVERYNPNRNTWEQVSNLTTRKHSFGLTCIKDILYSIGGHGNFSPGFKDVS
VYEPDQDKWHNLESAPKILRDVKAVSVEDRYVYVTARTPVDTDNEDGLKTVTTRYDTESR
QWQDVDSLPLIDNYCIFQMAVASTNFYHTASCCPKSYTVRDEVARQKISVRISDEILESL
PPEVTSIEGAAICHFDEDVFIIGGWKNSDDVDKQYRKEAYRYCAERKRWMLLPPMPQPRC
RATACHVRIPYRFLYGCQRYPMPQNLARQRDRMQQMQQLHRRTLTLRRQLQSQIEC
Download sequence
Identical sequences I3IXK9
ENSONIP00000001349 ENSONIP00000001349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]