SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3IZ30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3IZ30
Domain Number 1 Region: 376-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-47
Family SPRY domain 0.00082
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 6.63e-21
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 142-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3IZ30
Sequence length 557
Comment (tr|I3IZ30|I3IZ30_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000001870} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MAQKGVQLDRETFSCSICLDLLKDPVAIPCGHSYCMNCIKSFWDEEQKKKTYSCPQCRQT
FTPRPVLVKNTMLAVLVEQLKKTGLQAAPADHCYAGPEDVACDVCIGRKMKAFKSCLVCV
ISYCEQHVRLHYECPAFEKHKLVEPSKKLQENICSRHDEVMKMFCRTDQQSICYLCSVDE
HKGHDTVSAAAERTETQKQLLLSEGNRKAEFMSQKQSYLDHPDRMRTAKRSLSILIQNVD
SIFLSVLILIGFGSPHRWWKKVIRMASKFATMRAGGHHLMKPTELHHLRKDFTETHQGLQ
QHLNHLCQAQTIGVCSESTDSSSINIRPLSYFEDVTAAVSEVRDKLQDILREDWTNISLT
VTEVDVLLPQSEPKTRAEFLKYSREITFDPNTVHKNLVLSEGHRKSTFIFQDQSYSHHPD
RFTGYEQVLSRESLTGRCYWEMEWNGIGVDVAMTYKNINREGNECRFGRNYKSWALECNK
SSCTFWYNNIQIPISGPQSSRVGVYLDHRAGILSFYRVSKTMTLLHRVQTTFTQPLYAGV
YLSGWFVFGTSVEFCKL
Download sequence
Identical sequences I3IZ30
ENSONIP00000001870 ENSONIP00000001870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]