SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3IZK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3IZK2
Domain Number 1 Region: 693-888
Classification Level Classification E-value
Superfamily Sec7 domain 3.66e-73
Family Sec7 domain 0.00000257
Further Details:      
 
Domain Number 2 Region: 91-163,454-637,1147-1549,1677-1818
Classification Level Classification E-value
Superfamily ARM repeat 8.97e-28
Family MIF4G domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3IZK2
Sequence length 1846
Comment (tr|I3IZK2|I3IZK2_ORENI) ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) {ECO:0000313|Ensembl:ENSONIP00000002042} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=arfgef2 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MQQHRPPQQQQYSQSKAENSKTKSMFLSRALEKILSDKEVKRSQHSQLRKACQVALDEIK
EELEKQKDGTVVPPRANYIEADKYVLPFELACQSKSPRIVSTSLDCLQKLIAYGHITGNA
PDSRTPGKRLIDRLVETICNCFQGPQTDEGVQLQIIKALLTTVTSPHIEIHEGTVLLTVR
TCYNIYLASRNLINQTTAKATLTQMLNVIFTRMENQAALEAQEQEKERLRLPQQNPSPVP
SSRRSGSPRSDHTSTPEPQNSPSPAASTPDLTTNTSSSTHPSPAPDLDQDQEPDTPSVNG
EVESENTPPNGEAEQVTPSTDSVFEEEGAETSPTAAQQGDEGDKPESNSNPAEKGEQQPT
QTHVGAGGEHPPHPATEQTEVAPPRVRTEGQQMNGIIEDRSSLSSTDMLDAEALQGPHNA
ARFSHILQKDAFLVFRSLCKLSMKPLADGPPDPKSHELRSKIVSLQLLLSVLQGAGPVFR
THEMFVNAIKQYLCVALSKNGVSSVPEVFELSLAIFLTLLSHFKVHLKMQIEVFFREIFL
TILETSTSSFEHKWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQG
RSGQELGMTPLQELSLRKKGLECLVSILKCMVEWSKDMYVNPNLQANLGQEHPSDSEGAE
LKLPEQLAGRRDSISSLDSAISSSVAASQADHPEQYEVIKQQKDIIEHGIELFNKKPKRG
IQYLQDQGMLGPKAEDIAQFLHQEDRLDTTQVGEFLGENIKFNKEVMYCYVDQLDFCGRD
FVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTT
DLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYDEIAGKKIAMKESKEFSITPKS
TKQSVASEKQRRLLYNMEMEQMAKTAKALMEAVSHAQAPFFSATHLEHVRPMFKLAWTPL
LAAFSVGLQDCDDPEVASLCLEGIRCAIRIACIFSMQLERDAYVQALARFTLLTASSSIT
EMKQKNIDTIKTLITVAHTDGNYLGNSWHEILRCISQLELAQLIGTGVKTRYISGVVRDR
EGGIKGLPSGTEEFMPLGLGNLVGSQDKRQMAHIQESVGETSSQSVVVAVDRIFTGSTRL
DGNAIVDFVRWLCAVSMDELASAHQPRMFSLQKIVEISYYNMNRIRLQWSRIWQVIGDHF
NKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIRDM
VIRCVAQMVNSQAANIRSGWKNIFSVFHQAASDHDETIVELAFQTTGHIVLNTFREHFAA
AIDSFQDAVKCLSEFVCNAAFPDTSMEAIRLIRHCAKYVSDRPQALREYTSDDMNVAPGD
RVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWHDLFRIVFRIF
DNMKLPEQQTEKTEWMTTTCNHALYAICDVFTQFYEPLSEILLADIFTQLQWCVRQDNEQ
LARSGTNCLENLVILNGEKFSPEVWDITCSCMLEIFQNTSPQALLTWRPAGQDEEAADAK
HFDADFDTQSQSSYDRALSERGHSQMSSDDTWKGRSNARVSDQRLFAGLLIKCVVQLELI
QTVDNIVFYPATSKKEDADNMAAAQRDALEESEAEGRESGPDQGMYRHMTSAHLFKLLDC
LLESHTFAKDFNSNNEQRTALWRAGFKGKSKPNLLKQETSSLACSLRILFRMYSDPQLQD
SWPDIQTRLLLVCNEALGYFISLTSESHREAWNSLLMLLLTRTLRLPDDKFKPHASCYYP
HLCEMMQFDLIPELRAVLRRFFLRIGSVFHIAAAHPEGAPARTPAS
Download sequence
Identical sequences I3IZK2
XP_005477997.1.78416 ENSONIP00000002042 ENSONIP00000002042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]