SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3J1A5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3J1A5
Domain Number 1 Region: 12-174
Classification Level Classification E-value
Superfamily RUN domain-like 1.1e-40
Family RUN domain 0.00051
Further Details:      
 
Domain Number 2 Region: 1368-1482
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.53e-29
Family Supernatant protein factor (SPF), C-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 1158-1220
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.27e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 
Domain Number 4 Region: 426-649
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000981
Family Tropomyosin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3J1A5
Sequence length 1484
Comment (tr|I3J1A5|I3J1A5_ORENI) FYVE and coiled-coil domain containing 1a {ECO:0000313|Ensembl:ENSONIP00000002645} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MAAGTRVEENQLQRIIRDLHESVAELAKEYRETGEPITDDSTNLQKFANKLEYLLQFDQK
EKTTFLGTKKDYWDYFSECLAKIKGANDGIRFVKSITELKTSLGKGRAFIRYSLVHQRLA
DTLQQCLMNQRVTSDWYYARSPFLKPHLSVDIISHLYELNEVQFDVASRGYDLDASWPTF
ARRTLGSANSPGHMWKPPSRSSSINSLASSYSQVTDGLLNDLNESLPACREDVSEVEELR
LELDRSELKHRELLDKMQQLGEESEELRGVVVDLQRQLDASLTLNEQQKGLQENFQALQQ
RETALSREVEALRTGEQAKEAEQLLLQEKLAVAEGKNIELMAKLDGFLNEKGQQAAKSFD
SAQKIHELLDRLKEAEKGKLEAVAEVEKKRRQTERLEEELRVKETSAKDAETKLGALLSS
VSEEKVKEKEASNLQRQLQDLQRSLEEKEKEVVEVKKRAQEDKDEMQKNIGDLKESLEAE
VASLIEQLKGKEVELASSLETLQQLQSKNQGLITERDKLNTRIAELEGNVKEQATKIESC
KMEYSELEKEMAENRSVLEAELAALRASEKQLRSQLDDTKMTVDEKEKRLREENCKLDES
LQRATMAAKLSETTLKRLEQENQSLREEQNTVKAALNLVQADLKNAHGQIGELEKNLGAS
RKNEASLQEQLQVKEAQLESKETDLVKLQSRLNDLEAKEKELEIAKADAEATCAKQSEML
KSVTSEKQAMETVQLERSAVEAKENQEIIGKLAVVEGQLEVRMKEVSRLQAEVLDLRVQV
QRSEEENLKLKAQLEVTEAQRNELRTLTEQLKSQTEALNQKHVAELVECKKKEEALIEKH
DHEVAAHAELAIAAAAMREELSTLKAHNSKLALENNEIREGLHRANTEMAELGMTICKLS
AEKEEVRGHWEGDSGKIIELEKGVERLEKCMEELQLENNSLRKELTQKEALPQTIMELQE
ELEKTKNQVQTIKDSNREEMEAIKFQMSSESMNYQVQIKSLNEQLDKVTAELQEEQRNKS
SLQAKVSEQEMENPCFTKAENEEYLHLTREKDAHITKTEATIRENESEIQQLKDAATRAE
EALLAAQKTCEELKEKLKTTEADKQSSHLKMTAEIDDLNRTKTNLEERLIELLKDKDALW
QKSDALEFEQKLRAEERWWLVDQEATNCLDCKGQFTWWLRRHHCRLCGRIFCYYCSNNYV
VTKQSGKKERCCRHCYTELSPSDVQPPPPGPGPQPPPEPAPYIPTPRVTVSDPSNTSEAF
DIITEEEVNGVYDSDTTSQTTAGSLEGEQDRRHPGALDLQSGADADESLLCVLFSESACY
SVIKSTGEVTPDDEQVPTVQDSEINLLKSGEVTVAVPLTIDDISKFGESSRELFIKSSSY
SVITVAVIDSGPTISWMFSSEPKSISFSVVYRESTDTPVQQSKVLIPLTRCVSHKETIQG
QLKVRHPGLYTLIFDNSFSRFISKKVFYHLTMEKSIIYDGSDCP
Download sequence
Identical sequences I3J1A5
ENSONIP00000002645 ENSONIP00000002645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]