SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3J607 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3J607
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.13e-19
Family PB1 domain 0.0001
Further Details:      
 
Domain Number 2 Region: 215-266
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000742
Family ZZ domain 0.02
Further Details:      
 
Domain Number 3 Region: 942-979
Classification Level Classification E-value
Superfamily UBA-like 0.000000122
Family UBA domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3J607
Sequence length 990
Comment (tr|I3J607|I3J607_ORENI) Neighbor of brca1 gene 1b {ECO:0000313|Ensembl:ENSONIP00000004297} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100703217 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MDFYINLKVNFRGNSKNFLLSGSETKSWESMEAMVKRSFGLCSLQLTYFDEENEEVSINS
QAEYEEALKLAQSAMRQGNRLHMNVYETRGQPTRVATTKAGGAEPKRGFRPPQHCPSLAQ
VVSRKVQAAVPEQGMVIMKEVKGTKEEDKTPPAWFTSYMEKFKDQVVREAVEKICREFSG
QCCIHKPLGGGAETQQVPEVSSSTLPGAPSSSTPPCSSCRGQTTGGGYQCSVCTSCTLCE
PCSFSHDPSHNLVRARTPLSIPEHGSLRSKYLTKRCMFCFKDMWFYRRGDRSFRKAEKQR
LKAEKRLLKAEVKEIRKQLRMERRGIQWSSSHRDGSSSPVLLQPRATQHNSPERPKRPCP
LVVPAMTAAFLDENLPDGTRLRPGTKFIKYWKMRNTGTLSWSADTKLKFMWGNLAVGSGD
RWREVSVPFLQPGQVGIVSVALCAPTVEGSYTSHWRLAHAGEQFGPRVWCSIVVDPLAPA
PMMADGILVSPCVTPQSLTSLRHSCSLTNRCEFGKNPVAKDGKACAASREQPLLSVDQEE
YYIPSVDLLTAQDLLSFELLDINIVQELESAPTNTPADMTPCMSPLSQDGPLLDKGSPSL
GLIQEETEVINSIMDVPHGVGPGAEGGGVPAQEEGEDDISGTQFVCETVIRSMTLEEAPD
HIPLRGSCPGTVLQQIRQTGSHRLMIVGFFSVCIIVGSTLHYKAPRGDCEAEESHMESIC
VESRVREKQEEEEKRGVMRSRSSSTSSEDYIIILPDCFDTSRPLGESMYSSALSQPGDVQ
AKTATDPDTPSAERRDSAAREREADEVDEAAPGASSANDMLCTSQTLDDEPLTPEVVTPP
KAVVTSHPESSAEREEEDAGTEEGAQGSELYQTGDEAAPEHAQTDTEATDTEKCCSKQSP
HRQQGLTGGLVKGALSVAASAYKALFTGQGPTQPPVDASTQDTMMAVLVEMGFADRPLNQ
RLLKKHNYSLLDVVNELVQMTDNDWYSTRY
Download sequence
Identical sequences I3J607
ENSONIP00000004297 ENSONIP00000004297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]